PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.303990.2
Common NameCsa_5G148790, LOC101209208
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ARF
Protein Properties Length: 692aa    MW: 77024.4 Da    PI: 6.3945
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.303990.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.99.5e-24129230199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+kvlt sd++++g +++ +k+a+e+       + ++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + ++
  Cucsa.303990.2 129 FCKVLTASDTSTHGGFSVLRKHATEClppldmTLATP-TQDLVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLSAGDSFVFL--RGDN 220
                     99**************************999744433.458************************************************..3489 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     +el+v+v+r+
  Cucsa.303990.2 221 GELRVGVRRR 230
                     999*****97 PP

2Auxin_resp996.7e-33255333182
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                     a+ha++t++ F v+Y+Pr+   +F+++++k+++a+++k+svGmRf m+fe+eds+err+sGt++g  d++p +WpnS WrsL
  Cucsa.303990.2 255 ASHAVTTQTRFVVYYKPRT--CQFIISLNKYLEAVNNKFSVGMRFNMSFEGEDSPERRFSGTIIGAVDISP-HWPNSSWRSL 333
                     689***************6..89*********************************************999.*********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.36E-38120258IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-39122244IPR015300DNA-binding pseudobarrel domain
CDDcd100172.38E-20127229No hitNo description
PfamPF023627.7E-22129230IPR003340B3 DNA binding domain
SMARTSM010199.9E-23129231IPR003340B3 DNA binding domain
PROSITE profilePS5086312.337129231IPR003340B3 DNA binding domain
PfamPF065071.5E-30255333IPR010525Auxin response factor
PfamPF023094.9E-6567616IPR033389AUX/IAA domain
SuperFamilySSF542773.88E-14575656No hitNo description
PROSITE profilePS5174525.001580661IPR000270PB1 domain
PfamPF023091.4E-6625658IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MTYNGGDSYR QSCVSAQGCG RDDLYMELWR ACAGPLVDIP RVDERVFYFP QGHMEQLEAS  60
TNLELNKRIP LFNLDSKILC RVIHIEPLAD HESDEVYAQI TLMPESNQNE PKSMDPCPPE  120
PPRPVVHSFC KVLTASDTST HGGFSVLRKH ATECLPPLDM TLATPTQDLV AKDLHGYEWR  180
FKHIFRGQPR RHLLTTGWST FVTSKRLSAG DSFVFLRGDN GELRVGVRRR ARQQSSMPPS  240
VISSQSMHLG VLATASHAVT TQTRFVVYYK PRTCQFIISL NKYLEAVNNK FSVGMRFNMS  300
FEGEDSPERR FSGTIIGAVD ISPHWPNSSW RSLRVQWDEQ TSILRPDRVS PWDIEPLTSS  360
AVTGLSQPIS KNKRPRQPTP AHDGADLTKP THWDSGLAQS HDGKQCSNAA EGRKGENNES  420
CHHRETDTIS NSSCVSRTQT DTWLSPTQSN SYKHPVNDMA QDSKTVPSSG WTFLLGTPTS  480
HLVKLSDDQI LDPIESGKKG ETVASCRLFG IDLNHLAAEK ASSQPSSGSS DTDGRISTLS  540
VAQSDPKSDN LEVSIERKSE LSQASLKEIQ CNQSSSANTR SRTKVLMHGM AVGRAVDLTI  600
LEGYDQLIDE LEKMFDVRGQ LCARDKWEIV YTDDEGDMML VGDDPWEEFR NMVRRIFICS  660
KEQVKNMSSG SKQLTSIEVE GDVVTPVSPA V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1631835913357Auxin response factor 1
4ldw_A1e-1631835913357Auxin response factor 1
4ldw_B1e-1631835913357Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU3234160.0KU323416.1 UNVERIFIED: Trichosanthes dioica clone TdARF_14 auxin response factor 9-like mRNA, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011654692.10.0PREDICTED: auxin response factor 9
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A0A0KKD50.0A0A0A0KKD5_CUCSA; Auxin response factor
STRINGVIT_02s0025g01740.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]